PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00065.1.g02330.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 239aa    MW: 25414.7 Da    PI: 9.3363
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00065.1.g02330.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1131.3e-3573126558
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                                     +cprC s++tkfCyynny++sqPr+fC++CrryWt GG+lrnvP+Gg++rk+
  Zjn_sc00065.1.g02330.1.am.mk  73 GEQCPRCASHDTKFCYYNNYNTSQPRHFCRSCRRYWTLGGSLRNVPIGGSTRKR 126
                                   579*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.474128IPR003851Zinc finger, Dof-type
PfamPF027014.6E-3174126IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-2375121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MMEAPLHQQA SSLSLGPQLQ ANYKSDHHLA IATSVAAKMA VSGCGSTAET AYLQQLHQTT  60
AVTEANGNNG ARGEQCPRCA SHDTKFCYYN NYNTSQPRHF CRSCRRYWTL GGSLRNVPIG  120
GSTRKRPPLA HPTSAPPASR RHVVFGGGGA AAPPTGLLGS LFALRAWPRA SNAEWRGRCL  180
RWGGLGGASE LLWPAGLLDN GIADEWKVPS VSEATWPEFF AAVAPPQAGG LLHGGAQLM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072062e-74AC107206.4 Oryza sativa chromosome 3 BAC OSJNBa0063J18 genomic sequence, complete sequence.
GenBankAK1198032e-74AK119803.1 Oryza sativa Japonica Group cDNA clone:002-176-F03, full insert sequence.
GenBankAP0149592e-74AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126112e-74CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698063.16e-47PREDICTED: dof zinc finger protein DOF1.6
TrEMBLA5HWF63e-48A5HWF6_HORVD; Dof zinc finger protein 7
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-28DOF zinc finger protein 1